General Information

  • ID:  hor006763
  • Uniprot ID:  Q8N6N7
  • Protein name:  Acyl-CoA-binding domain-containing protein 7
  • Gene name:  ACBD7
  • Organism:  Homo sapiens (Human)
  • Family:  ACBD7 family
  • Source:  Human
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0000062 fatty-acyl-CoA binding; GO:0005515 protein binding; GO:0008289 lipid binding
  • GO BP:  GO:0006631 fatty acid metabolic process
  • GO CC:  NA

Sequence Information

  • Sequence:  MALQADFDRAAEDVRKLKARPDDGELKELYGLYKQAIVGDINIACPGMLDLKGKAKWEAWNLKKGLSTEDATSAYISKAKELIEKYGI
  • Length:  88(1-88)
  • Propeptide:  MALQADFDRAAEDVRKLKARPDDGELKELYGLYKQAIVGDINIACPGMLDLKGKAKWEAWNLKKGLSTEDATSAYISKAKELIEKYGI
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Binds medium- and long-chain acyl-CoA esters.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q8N6N7-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-Q8N6N7-F1.pdbhor006763_AF2.pdbhor006763_ESM.pdb

Physical Information

Mass: 1134236 Formula: C438H705N115O132S3
Absent amino acids: H Common amino acids: AK
pI: 6.7 Basic residues: 15
Polar residues: 19 Hydrophobic residues: 33
Hydrophobicity: -44.89 Boman Index: -14033
Half-Life / Aliphatic Index: 30 hour Aliphatic Index: 91.14
Instability Index: 2947.73 Extinction Coefficient cystines: 16960
Absorbance 280nm: 194.94

Literature

  • PubMed ID:  14702039
  • Title:  Complete sequencing and characterization of 21,243 full-length human cDNAs.
  • PubMed ID:  15164054
  • Title:  The DNA sequence and comparative analysis of human chromosome 10.
  • PubMed ID:  15489334
  • Title:  The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).